| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPN1. This antibody reacts with human. The CPN1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD. |
|---|
| Other Names | ACBP, Anaphylatoxin inactivator, Arginine carboxypeptidase, Carboxypeptidase N polypeptide 1, carboxypeptidase N polypeptide 1 50 kD, Carboxypeptidase N small subunit, carboxypeptidase N, polypeptide 1, carboxypeptidase N, polypeptide 1, 50kD, CPNcarboxypeptidase N catalytic chain, EC 3.4.17, EC 3.4.17.3, FLJ40792, kininase I, Kininase-1, Lysine carboxypeptidase, Plasma carboxypeptidase B, SCPNcarboxypeptidase N catalytic subunit, Serum carboxypeptidase N |
|---|
| Gene, Accession # | CPN1, Gene ID: 1369, Accession: P15169, SwissProt: P15169 |
|---|
| Catalog # | NBP1-58016-20ul |
|---|
| Price | |
|---|
| Order / More Info | CPN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|