| 产品详情 |
| Edit |   |
| Antigenic Specificity | CPN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CPN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPN1. This antibody reacts with human. The CPN1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT. |
| Other Names | ACBP, Anaphylatoxin inactivator, Arginine carboxypeptidase, Carboxypeptidase N polypeptide 1, carboxypeptidase N polypeptide 1 50 kD, Carboxypeptidase N small subunit, carboxypeptidase N, polypeptide 1, carboxypeptidase N, polypeptide 1, 50kD, CPNcarboxypeptidase N catalytic chain, EC 3.4.17, EC 3.4.17.3, FLJ40792, kininase I, Kininase-1, Lysine carboxypeptidase, Plasma carboxypeptidase B, SCPNcarboxypeptidase N catalytic subunit, Serum carboxypeptidase N |
| Gene, Accession # | CPN1, Gene ID: 1369, Accession: P15169, SwissProt: P15169 |
| Catalog # | NBP1-57960 |
| Price | |
| Order / More Info | CPN1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|