| Edit |   |
|---|
| Antigenic Specificity | RUNX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human. No cross reactivity with other proteins. Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence. |
|---|
| Other Names | Runt-related transcription factor 2;Acute myeloid leukemia 3 protein;Core-binding factor subunit alpha-1;CBF-alpha-1;Oncogene AML-3;Osteoblast-specific transcription factor 2;OSF-2;Polyomavirus enhancer-binding protein 2 alpha A subunit;PEA2-alpha A;PEBP2-alpha A;SL3-3 enhancer factor 1 alpha A subunit;SL3/AKV core-binding factor alpha A subunit;RUNX2;AML3, CBFA1, OSF2, PEBP2A; |
|---|
| Gene, Accession # | RUNX2, UniProt: Q13950 |
|---|
| Catalog # | PB9158 |
|---|
| Price | |
|---|
| Order / More Info | RUNX2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|