| Edit |   |
| Antigenic Specificity | PNMA6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNMA6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA6A. This antibody reacts with human. The PNMA6A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PNMA6AThe immunogen for this antibody is PNMA6A. Peptide sequence FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS. |
| Other Names | MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6 |
| Gene, Accession # | PNMA6A, Gene ID: 84968, Accession: NP_116271, SwissProt: NP_116271 |
| Catalog # | NBP1-79867 |
| Price | |
| Order / More Info | PNMA6A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |