| Edit |   |
|---|
| Antigenic Specificity | PNMA6A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNMA6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA6A. This antibody reacts with human. The PNMA6A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human PNMA6AThe immunogen for this antibody is PNMA6A. Peptide sequence FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS. |
|---|
| Other Names | MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6 |
|---|
| Gene, Accession # | PNMA6A, Gene ID: 84968, Accession: NP_116271, SwissProt: NP_116271 |
|---|
| Catalog # | NBP1-79867-20ul |
|---|
| Price | |
|---|
| Order / More Info | PNMA6A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|