| Edit |   |
| Antigenic Specificity | GAPDH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GAPDH polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG |
| Other Names | glyceraldehyde-3-phosphate dehydrogenase, GAPD |
| Gene, Accession # | Gene ID: 2597, UniProt: P04406, ENSG00000111640 |
| Catalog # | HPA061280 |
| Price | |
| Order / More Info | GAPDH Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |