| Edit |   |
|---|
| Antigenic Specificity | GAPDH |
|---|
| Clone | CL3266 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 94%) |
|---|
| Isotype | IgG2a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Genetic validation in WB by siRNA knockdown. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse anti-human GAPDH monoclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS |
|---|
| Other Names | glyceraldehyde-3-phosphate dehydrogenase, GAPD |
|---|
| Gene, Accession # | Gene ID: 2597, UniProt: P04406, ENSG00000111640 |
|---|
| Catalog # | AMAb91153 |
|---|
| Price | |
|---|
| Order / More Info | GAPDH Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|