| Edit |   |
| Antigenic Specificity | IL6R/Il 6 R Alpha |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-IL6R/Il 6 R Alpha Picoband Antibody. Reactivity: Human No cross reactivity with other proteins. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).Subcellular Localization: Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein.Tissue Specificity: Isoform 2 is expressed in peripheral blood m |
| Other Names | interleukin-6 receptor subunit alpha isoform 1; Interleukin-6 receptor subunit alpha; interleukin-6 receptor subunit alpha; interleukin 6 receptor; IL-6R 1; Membrane glycoprotein 80; gp80; CD_antigen: CD126, IL6R; IL6R; IL6Q; gp80; CD126; IL6RA; IL6RQ; IL-6RA; IL-6R-1; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; gp80 |
| Gene, Accession # | IL6R, Gene ID: 3570, NCBI: NP_000556.1, UniProt: P08887 |
| Catalog # | MBS1750643 |
| Price | |
| Order / More Info | IL6R/Il 6 R Alpha Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |