| 产品详情 |
| Edit |   |
| Antigenic Specificity | HMGCS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HMGCS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HMGCS1. This antibody reacts with human. The HMGCS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HMGCS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLRE DTHHLVNYIPQGSIDSLFEGTWY |
| Other Names | 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase, 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble), EC 2.3.3.10, HMG-CoA synthase, HMGCS, hydroxymethylglutaryl-CoA synthase, cytoplasmic, MGC90332 |
| Gene, Accession # | HMGCS1, Gene ID: 3157 |
| Catalog # | NBP2-14094 |
| Price | |
| Order / More Info | HMGCS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|