| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HMGCS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HMGCS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HMGCS2. This antibody reacts with human. The HMGCS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HMGCS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVE |
|---|
| Other Names | 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial), EC 2.3.3.10, HMG-CoA synthase, hydroxymethylglutaryl-CoA synthase, mitochondrial, mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase |
|---|
| Gene, Accession # | HMGCS2, Gene ID: 3158, Accession: P54868, SwissProt: P54868 |
|---|
| Catalog # | NBP2-33908 |
|---|
| Price | |
|---|
| Order / More Info | HMGCS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|