| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HMGCS2 |
|---|
| Clone | 1E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HMGCS2 Antibody (1E9) from Novus Biologicals is a mouse monoclonal antibody to HMGCS2. This antibody reacts with human. The HMGCS2 Antibody (1E9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | HMGCS2 (NP_005509.1 424 a.a. - 508 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV |
|---|
| Other Names | 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial), EC 2.3.3.10, HMG-CoA synthase, hydroxymethylglutaryl-CoA synthase, mitochondrial, mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase |
|---|
| Gene, Accession # | HMGCS2, Gene ID: 3158, Accession: NP_005509, SwissProt: NP_005509 |
|---|
| Catalog # | H00003158-M06 |
|---|
| Price | |
|---|
| Order / More Info | HMGCS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|