| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PKM2 |
|---|
| Clone | 2D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PKM2 Antibody (2D8) from Novus Biologicals is a mouse monoclonal antibody to PKM2. This antibody reacts with human. The PKM2 Antibody (2D8) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PKM2 (NP_002645 436 a.a. - 531 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP |
|---|
| Other Names | CTHBP, Cytosolic thyroid hormone-binding protein, MGC3932, OIP-3, OIP3EC 2.7.1.40, Opa-interacting protein 3, PK, muscle type, PK2, PK3PKM, Pyruvate kinase 2/3, pyruvate kinase isozymes M1/M2, Pyruvate kinase muscle isozyme, pyruvate kinase, muscle, TCB, THBP1p58, Thyroid hormone-binding protein 1, thyroid hormone-binding protein, cytosolic, Tumor M2-PK |
|---|
| Gene, Accession # | PKM, Gene ID: 5315, Accession: NP_002645, SwissProt: NP_002645 |
|---|
| Catalog # | H00005315-M08 |
|---|
| Price | |
|---|
| Order / More Info | PKM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|