| Edit |   |
|---|
| Antigenic Specificity | Spinster Homolog 1 (Drosophila) (SPNS1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family. |
|---|
| Immunogen | SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT |
|---|
| Other Names | etID64740.3|nrs|spinl|wu:fb95b12|wu:fi37e11|2210013K02Rik|Spin1|Spinl|HSpin1|LAT|PP2030|SPIN1|SPINL|spinster|RGD1305613 |
|---|
| Gene, Accession # | Gene ID: 83985,73658,361648 |
|---|
| Catalog # | ABIN635490 |
|---|
| Price | |
|---|
| Order / More Info | Spinster Homolog 1 (Drosophila) (SPNS1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|