| Edit |   |
|---|
| Antigenic Specificity | Tu Translation Elongation Factor, Mitochondrial (Tufm) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. |
|---|
| Immunogen | TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM |
|---|
| Other Names | TUFM|D250|fi06f04|wu:fi06f04|zgc:110766|COXPD4|EF-TuMT|EFTU|P43|2300002G02Rik|C76308|C76389 |
|---|
| Gene, Accession # | Gene ID: 7284 |
|---|
| Catalog # | ABIN631117 |
|---|
| Price | |
|---|
| Order / More Info | Tu Translation Elongation Factor, Mitochondrial (Tufm) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|