| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TVP23A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TVP23A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TVP23A. This antibody reacts with human. The TVP23A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TVP23A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH |
|---|
| Other Names | FAM18A, Family With Sequence Similarity 18, Member A, Golgi Apparatus Membrane Protein TVP23 Homolog A, Protein FAM18A, Trans-Golgi Network Vesicle Protein 23 Homolog A (S. Cerevisiae), YDR084C |
|---|
| Gene, Accession # | Gene ID: 780776 |
|---|
| Catalog # | NBP2-32556 |
|---|
| Price | |
|---|
| Order / More Info | TVP23A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|