| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TWA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TWA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TWA1. This antibody reacts with human. The TWA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TWA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE |
|---|
| Other Names | bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM |
|---|
| Gene, Accession # | GID8, Gene ID: 54994 |
|---|
| Catalog # | NBP2-55320 |
|---|
| Price | |
|---|
| Order / More Info | TWA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|