| Edit |   |
| Antigenic Specificity | Glucosamine (N-Acetyl)-6-Sulfatase (GNS) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. |
| Immunogen | GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA |
| Other Names | NV14559|N-acetylglucosamine-6-sulfatase|zgc:114066|G6S|2610016K11Rik|AU042285|C87209|N28088|gns|wu:fi20h10|zgc:55370 |
| Gene, Accession # | Gene ID: 2799,75612,299825 |
| Catalog # | ABIN635775 |
| Price | |
| Order / More Info | Glucosamine (N-Acetyl)-6-Sulfatase (GNS) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |