| Edit |   |
| Antigenic Specificity | Glucosamine (N-acetyl)-6-Sulfatase/GNS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glucosamine (N-acetyl)-6-Sulfatase/GNS. This antibody reacts with rat. The Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns. Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV. |
| Other Names | EC 3.1.6, EC 3.1.6.14, G6Sglucosamine-6-sulfatase, glucosamine (N-acetyl)-6-sulfatase, Glucosamine-6-sulfatase, MGC21274, N-acetylglucosamine-6-sulfatase |
| Gene, Accession # | GNS, Gene ID: 2799, Accession: Q5M918 |
| Catalog # | NBP1-68917 |
| Price | |
| Order / More Info | Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |