| Edit |   |
|---|
| Antigenic Specificity | Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface. |
|---|
| Immunogen | GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
|---|
| Other Names | C2/4GnT|C24GNT|C2GNT2|C2GNTM|GNTM|2010013H22Rik|2210021I22Rik|2210401J11Rik|beta-16-N-acetylglucosaminyltransferase|dI/C2/C4GnT|c2/4gnt|c24gnt|c2gnt2|c2gntm|gntm |
|---|
| Gene, Accession # | Gene ID: 9245 |
|---|
| Catalog # | ABIN630484 |
|---|
| Price | |
|---|
| Order / More Info | Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|