| Edit |   |
| Antigenic Specificity | KERA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KERA Antibody from Novus Biologicals is a rabbit polyclonal antibody to KERA. This antibody reacts with mouse. The KERA Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Kera - C-terminal region. Peptide sequence MQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRL. |
| Other Names | CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan |
| Gene, Accession # | KERA, Gene ID: 11081, Accession: NP_032464 |
| Catalog # | NBP1-98389 |
| Price | |
| Order / More Info | KERA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |