| Edit |   |
| Antigenic Specificity | Glutaredoxin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glutaredoxin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutaredoxin 2. This antibody reacts with human. The Glutaredoxin 2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human GLRX2. Peptide sequence NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH. |
| Other Names | bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin 2, glutaredoxin-2, mitochondrial, GRX2bA101E13.1 |
| Gene, Accession # | GLRX2, Gene ID: 51022, Accession: NP_932066, SwissProt: NP_932066 |
| Catalog # | NBP1-79689-20ul |
| Price | |
| Order / More Info | Glutaredoxin 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |