| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTP epsilon |
|---|
| Clone | 2D10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTP epsilon Antibody (2D10) from Novus Biologicals is a mouse monoclonal antibody to PTP epsilon. This antibody reacts with human. The PTP epsilon Antibody (2D10) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PTPRE (AAH50062 511 a.a. - 600 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI |
|---|
| Other Names | DKFZp313F1310, EC 3.1.3.48, FLJ57799, FLJ58245, HPTPE, protein tyrosine phosphatase epsilon, protein tyrosine phosphatase, receptor type, E, protein tyrosine phosphatase, receptor type, epsilon polypeptide, Protein-tyrosine phosphatase epsilon, PTPE, receptor-type tyrosine-protein phosphatase epsilon, R-PTP-EPSILON |
|---|
| Gene, Accession # | PTPRE, Gene ID: 5791, Accession: AAH50062, SwissProt: AAH50062 |
|---|
| Catalog # | H00005791-M04 |
|---|
| Price | |
|---|
| Order / More Info | PTP epsilon Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|