| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Periostin/OSF-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Periostin/OSF-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Periostin/OSF-2. This antibody reacts with human. The Periostin/OSF-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL. |
|---|
| Other Names | MGC119510, MGC119511, OSF-2osteoblast specific factor 2 (fasciclin I-like), OSF2periodontal ligament-specific periostin, Osteoblast-specific factor 2, PDLPOSTN, periostin, periostin isoform thy2, periostin isoform thy4, periostin isoform thy6, periostin isoform thy8, periostin, osteoblast specific factor, PNRP11-412K4.1 |
|---|
| Gene, Accession # | POSTN, Gene ID: 10631, Accession: Q15063, SwissProt: Q15063 |
|---|
| Catalog # | NBP1-59151 |
|---|
| Price | |
|---|
| Order / More Info | Periostin/OSF-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28902360 |
|---|
| 产品资料 |
|
|