| Edit |   |
|---|
| Antigenic Specificity | B-Cell Linker (BLNK) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. |
|---|
| Immunogen | BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
|---|
| Other Names | BLNK|blnk|MGC147045|BASH|Bca|Ly-57|Ly57|Lyw-57|SLP-65|AGM4|BLNK-S|LY57|SLP65|bca |
|---|
| Gene, Accession # | Gene ID: 29760,17060,499356 |
|---|
| Catalog # | ABIN634309 |
|---|
| Price | |
|---|
| Order / More Info | B-Cell Linker (BLNK) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|