| Edit |   |
| Antigenic Specificity | EPH receptor B4 |
| Clone | CPTC-EPHB4-1 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b |
| Format | HYBRIDOMA |
| Size | 1 vial cells |
| Concentration | n/a |
| Applications | ELISA |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Antibody has been characterized only by ELISA or western blot. |
| Immunogen | Recombinant Domain: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD |
| Other Names | EPH receptor B4; HTK; MYK1; Hepatoma transmembrane kinase; Tyrosine-protein kinase TYRO11; TYRO11; EC 2.7.10.1; EPHB4; ephrin type-B receptor 4; soluble EPHB4 variant 1; soluble EPHB4 variant 2; soluble EPHB4 variant 3; tyrosine-protein kinase receptor HTK; EC 2.7.10 |
| Gene, Accession # | EPHB4, Gene ID: 2050, UniProt: P54760 |
| Catalog # | CPTC-EPHB4-1 |
| Price | |
| Order / More Info | EPH receptor B4 Antibody from DEVELOPMENTAL STUDIES HYBRIDOMA BANK |
| Product Specific References | n/a |