| Edit |   |
|---|
| Antigenic Specificity | SH2D6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH2D6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH2D6. This antibody reacts with human. The SH2D6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SH2D6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRE |
|---|
| Other Names | SH2 Domain Containing 6, SH2 Domain-Containing Protein 6 |
|---|
| Gene, Accession # | SH2D6, Gene ID: 284948, Accession: Q7Z4S9, SwissProt: Q7Z4S9 |
|---|
| Catalog # | NBP2-30554 |
|---|
| Price | |
|---|
| Order / More Info | SH2D6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|