| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SH3D19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH3D19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3D19. This antibody reacts with human. The SH3D19 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SH3D19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN |
|---|
| Other Names | ADAM binding protein Eve-1, ADAM-binding protein Eve-1, DKFZp434D0215, EBPMGC118912, EEN binding protein, EEN-binding protein, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118913, SH3 domain containing 19, SH3 domain protein D19, SH3 domain-containing protein 19, SH3P19 |
|---|
| Gene, Accession # | SH3D19, Gene ID: 152503 |
|---|
| Catalog # | NBP2-56246 |
|---|
| Price | |
|---|
| Order / More Info | SH3D19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|