| Edit |   |
| Antigenic Specificity | UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation. |
| Immunogen | UGCGL2 antibody was raised using the N terminal of µgCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR |
| Other Names | UGCGL2|ugcgl2|im:7146988|wu:fi13a08|HUGT2|UGT2|1810064L21Rik|3110001A05Rik|3110027P15Rik|A230065J02Rik|AW047562|Ugcgl2 |
| Gene, Accession # | Gene ID: 55757 |
| Catalog # | ABIN633912 |
| Price | |
| Order / More Info | UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |