| Edit |   |
| Antigenic Specificity | UDP-Glucose Pyrophosphorylase 2 (UGP2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. |
| Immunogen | UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN |
| Other Names | si:ch73-233a22.2|DDBDRAFT_0204359|DDBDRAFT_0214911|DDB_0204359|DDB_0214911|AtUGP1|T17B22.6|T17B22_6|UDP-GLUCOSE PYROPHOSPHORYLASE 1|UDP-glucose pyrophosphorylase|UGP|UGPASE|UDPG|UDPGP|UDPGP2|UGP1|UGPP1|UGPP2|pHC379|Ugp2|fi53h10|wu:fi53h10|zgc:85662 |
| Gene, Accession # | Gene ID: 7360,216558,289827 |
| Catalog # | ABIN632677 |
| Price | |
| Order / More Info | UDP-Glucose Pyrophosphorylase 2 (UGP2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |