| Edit |   |
|---|
| Antigenic Specificity | NmrA-Like Family Domain Containing 1 (NMRAL1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of this protein is binding, oxidoreductase activity and transcription repressor activity. |
|---|
| Immunogen | NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA |
|---|
| Other Names | HSCARG|SDR48A1|1110025F24Rik|AI256624|RGD1311451 |
|---|
| Gene, Accession # | Gene ID: 57407 |
|---|
| Catalog # | ABIN631947 |
|---|
| Price | |
|---|
| Order / More Info | NmrA-Like Family Domain Containing 1 (NMRAL1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|