| Edit |   |
| Antigenic Specificity | FAM190A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM190A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM190A. This antibody reacts with human. The FAM190A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC48628(similar to KIAA1680 protein) The peptide sequence was selected from the N terminal of MGC48628. Peptide sequence HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS. |
| Other Names | family with sequence similarity 190, member A, KIAA1680 protein, KIAA1680MGC48628 |
| Gene, Accession # | CCSER1, Gene ID: 401145, Accession: Q9C0I3-2, SwissProt: Q9C0I3-2 |
| Catalog # | NBP1-56658-20ul |
| Price | |
| Order / More Info | FAM190A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |