| Edit |   |
|---|
| Antigenic Specificity | FAM190A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM190A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM190A. This antibody reacts with human. The FAM190A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC48628(similar to KIAA1680 protein) The peptide sequence was selected from the N terminal of MGC48628. Peptide sequence HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS. |
|---|
| Other Names | family with sequence similarity 190, member A, KIAA1680 protein, KIAA1680MGC48628 |
|---|
| Gene, Accession # | CCSER1, Gene ID: 401145, Accession: Q9C0I3-2, SwissProt: Q9C0I3-2 |
|---|
| Catalog # | NBP1-56658 |
|---|
| Price | |
|---|
| Order / More Info | FAM190A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|