| Edit |   |
|---|
| Antigenic Specificity | FAM207A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM207A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM207A. This antibody reacts with human. The FAM207A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is FAM207A - N-terminal region. Peptide sequence AAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSAL. |
|---|
| Other Names | chromosome 21 open reading frame 70, hypothetical protein LOC85395, PRED56 |
|---|
| Gene, Accession # | FAM207A, Gene ID: 85395, Accession: NP_478070, SwissProt: NP_478070 |
|---|
| Catalog # | NBP1-98325-20ul |
|---|
| Price | |
|---|
| Order / More Info | FAM207A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|