| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM213A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM213A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM213A. This antibody reacts with human, rat. The FAM213A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, rat FAM213A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK |
|---|
| Other Names | C10orf58, Chromosome 10 Open Reading Frame 58, Family With Sequence Similarity 213, Member A, PAMM, Peroxiredoxin (PRX)-Like 2 Activated In M-CSF Stimulated Monocytes, Peroxiredoxin-Like 2 Activated In M-CSF Stimulated Monocytes, Protein PAMM, Redox-Regulatory Protein PAMM, UPF0765 Protein C10orf58 |
|---|
| Gene, Accession # | FAM213A, Gene ID: 84293 |
|---|
| Catalog # | NBP2-48573 |
|---|
| Price | |
|---|
| Order / More Info | FAM213A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|