| Edit |   |
| Antigenic Specificity | FAM217A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM217A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM217A. This antibody reacts with human. The FAM217A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C6orf146. Peptide sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP. |
| Other Names | C6orf146, chromosome 6 open reading frame 146, family with sequence similarity 217, member A, hypothetical protein LOC222826 |
| Gene, Accession # | FAM217A, Gene ID: 222826, Accession: NP_775834, SwissProt: NP_775834 |
| Catalog # | NBP1-91462 |
| Price | |
| Order / More Info | FAM217A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |