| Edit |   |
|---|
| Antigenic Specificity | APIP (APIP) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury. |
|---|
| Immunogen | APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV |
|---|
| Other Names | APIP2|CGI29|MMRP19|dJ179L10.2|hAPIP|CGI-29|Mmrp19|RGD1564562|zgc:103619 |
|---|
| Gene, Accession # | Gene ID: 51074,56369,295961 |
|---|
| Catalog # | ABIN633024 |
|---|
| Price | |
|---|
| Order / More Info | APIP (APIP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|