| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LPCAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LPCAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LPCAT1. This antibody reacts with human. The LPCAT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LPCAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC |
|---|
| Other Names | 1-acylglycerophosphocholine O-acyltransferase, Acetyl-CoA:lyso-PAF acetyltransferase, Acetyl-CoA:lyso-platelet-activating factor acetyltransferase, acyl-CoA:lysophosphatidylcholine acyltransferase 1, acyltransferase like 2, Acyltransferase-like 2, AYTL2, EC 2.3.1.-, EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase, EC 2.3.1.67, FLJ12443, FLJ41609, LPC acyltransferase 1, lpcat, LPCAT-1, Lyso-PAF acetyltransferase, lysoPAFAT, LysoPC acyltransferase 1, lysophosphatidylcholine acyltransferase 1, PFAAP3, Phosphonoformate immuno-associated protein 3, regulated by phosphonoformate |
|---|
| Gene, Accession # | LPCAT1, Gene ID: 79888 |
|---|
| Catalog # | NBP1-88922 |
|---|
| Price | |
|---|
| Order / More Info | LPCAT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|