| Edit |   |
|---|
| Antigenic Specificity | Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. |
|---|
| Immunogen | JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
|---|
| Other Names | JARID2|jarid2|jmj|Jmj|jumonji|JMJ |
|---|
| Gene, Accession # | Gene ID: 3720 |
|---|
| Catalog # | ABIN633819 |
|---|
| Price | |
|---|
| Order / More Info | Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|