| Edit |   |
|---|
| Antigenic Specificity | Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | JHDM1D belongs to the JHDM1 histone demethylase family. It contains 1 JmjC domain and 1 PHD-type zinc finger. The function of JHDM1D remains unknown. |
|---|
| Immunogen | JHDM1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids: PDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQSRNYVDSS |
|---|
| Other Names | KDM7A|A630082K20Rik|BB041802|ENSMUSG00000073143|Kdm7a|mKIAA1718 |
|---|
| Gene, Accession # | Gene ID: 80853 |
|---|
| Catalog # | ABIN630977 |
|---|
| Price | |
|---|
| Order / More Info | Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|