| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IGSF1 |
|---|
| Clone | 4C7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IGSF1 Antibody (4C7) from Novus Biologicals is a mouse monoclonal antibody to IGSF1. This antibody reacts with human, rat. The IGSF1 Antibody (4C7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | IGSF1 (NP_001546 220 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD |
|---|
| Other Names | IGDC1Pituitary gland-specific factor 2, IgSF1, immunoglobulin superfamily member 1, immunoglobulin superfamily, member 1, Immunoglobulin-like domain-containing protein 1, InhBP, Inhibin-binding protein, KIAA0364p120, MGC75490, PGSF2IGCD1 |
|---|
| Gene, Accession # | IGSF1, Gene ID: 3547, Accession: NP_001546, SwissProt: NP_001546 |
|---|
| Catalog # | H00003547-M01 |
|---|
| Price | |
|---|
| Order / More Info | IGSF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|