| Edit |   |
|---|
| Antigenic Specificity | TTC9C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC9C Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC9C. This antibody reacts with human. The TTC9C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TTC9C(tetratricopeptide repeat domain 9C) The peptide sequence was selected from the N terminal of TTC9C. Peptide sequence MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP. |
|---|
| Other Names | MGC29649, tetratricopeptide repeat domain 9C, tetratricopeptide repeat protein 9C, TPR repeat protein 9C |
|---|
| Gene, Accession # | TTC9C, Gene ID: 283237, Accession: Q8N5M4, SwissProt: Q8N5M4 |
|---|
| Catalog # | NBP1-55306-20ul |
|---|
| Price | |
|---|
| Order / More Info | TTC9C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|