| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMPK beta 1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-AMPK beta 1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | 5'-AMP-activated protein kinase subunit beta-1; 5'-AMP-activated protein kinase subunit beta-1; 5'-AMP-activated protein kinase subunit beta-1; protein kinase AMP-activated non-catalytic subunit beta 1, PRKAB1; PRKAB1; AMPK; HAMPKb; AMPK; AMPK subunit beta-1; AMPKb |
|---|
| Gene, Accession # | AMPK beta 1, Gene ID: 5564, NCBI: NP_006244.2, UniProt: Q9Y478 |
|---|
| Catalog # | MBS177690 |
|---|
| Price | |
|---|
| Order / More Info | AMPK beta 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit. 2. Stapleton D, Mitchelhill KI, Gao G, Widmer J, Michell BJ, Teh T, House CM, Fernandez CS, Cox T, Witters LA, Kemp BE (February 1996). Mammalian AMP-activated protein kinase subfamily. J Biol Chem 271 (2): 611-4. |
|---|
| 产品资料 |
|
|