| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMPK beta 2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-AMPK beta 2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | 5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase subunit beta-2; protein kinase AMP-activated non-catalytic subunit beta 2, PRKAB2; PRKAB2; AMPK subunit beta-2 |
|---|
| Gene, Accession # | AMPK beta 2, Gene ID: 5565, NCBI: NP_005390.1, UniProt: O43741 |
|---|
| Catalog # | MBS178315 |
|---|
| Price | |
|---|
| Order / More Info | AMPK beta 2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit. 2. Stapleton D, Mitchelhill KI, Gao G, Widmer J, Michell BJ, Teh T, House CM, Fernandez CS, Cox T, Witters LA, Kemp BE (February 1996). Mammalian AMP-activated protein kinase subfamily. J Biol Chem 271 (2): 611-4. |
|---|
| 产品资料 |
|
|