| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTF2A1 |
|---|
| Clone | 2H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF2A1 Antibody (2H5) from Novus Biologicals is a mouse monoclonal antibody to GTF2A1. This antibody reacts with human. The GTF2A1 Antibody (2H5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GTF2A1 (NP_056943, 1 a.a. - 63 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE |
|---|
| Other Names | General transcription factor IIA subunit 1, general transcription factor IIA, 1, 19/37kDa, glucose regulated protein, 58kD pseudogene, MGC129969, MGC129970, TF2A1, TFIIA, TFIIA alpha, p55, TFIIA-42, TFIIAL, transcription initiation factor IIA subunit 1, Transcription initiation factor TFIIA 42 kDa subunit |
|---|
| Gene, Accession # | GTF2A1, Gene ID: 2957, Accession: NP_056943, SwissProt: NP_056943 |
|---|
| Catalog # | H00002957-M01 |
|---|
| Price | |
|---|
| Order / More Info | GTF2A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|