| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SCNN1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | n/a |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-SCNN1A Picoband antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human SCNN1A (QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK).Subcellular Localization: Apical cell membrane.Tissue Specificity: Expressed in the female reproductive tract, from the fimbrial end of the fallopian tube to the endometrium (at protein level) (P |
|---|
| Other Names | amiloride-sensitive sodium channel subunit alpha isoform 1; Amiloride-sensitive sodium channel subunit alpha; amiloride-sensitive sodium channel subunit alpha; sodium channel epithelial 1 alpha subunit; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; ENaCA; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA, SCNN1A; SCNN1A; BESC2; ENaCa; SCNEA; SCNN1; ENaCalpha; SCNN1; Alpha-ENaC; ENaCA |
|---|
| Gene, Accession # | SCNN1A, Gene ID: 6337, NCBI: NP_001029.1, UniProt: P37088 |
|---|
| Catalog # | MBS1750640 |
|---|
| Price | |
|---|
| Order / More Info | SCNN1A Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|