| 产品详情 |
| Edit |   |
| Antigenic Specificity | SUR1/SUR2B |
| Clone | S323A-31 |
| Host Species | Mouse |
| Reactive Species | mouse, rat |
| Isotype | IgG1 |
| Format | ATTO 488 conjugate |
| Size | 100 µg |
| Concentration | 1 mg/ml |
| Applications | WB, ICC/IF. RUO |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1. Detects ~175kDa and smaller fragments likely due to proteolytic cleavage. 1 µg/ml of SMC-432 was sufficient for detection of SUR1 and SUR2B in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. |
| Immunogen | Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B |
| Other Names | ABC36 , Abcc8 , ABCC8_HUMAN , ATP binding cassette sub family C (CFTR/MRP) member 8 , ATP binding cassette transporter sub family C member 8 (1) , ATP-binding cassette sub-family C member 8 , HHF1 , HI , HRINS , MRP8 , PHHI , Sulfonylurea receptor (hyperinsulinemia) , Sulfonylurea receptor 1 , SUR , SUR1 , SUR1delta2 , TNDM2 , ABC37 , abcC9 , ABCC9_HUMAN , AI414027 , AI449286 , ATFB12 , ATP-binding cassette sub-family C member 9 , ATP-binding cassette transporter sub-family C member 9 , ATP-binding cassette , sub-family C (CFTR/MRP) , member 9 , CANTU , CMD1O , FLJ36852 , Sulfonylurea receptor 2 , Sulfonylurea-binding protein 2 , SUR2 , SUR2A , SUR2B |
| Gene, Accession # | Gene ID: 25560, Accession: NP_037172.2, SwissProt: Q63563 |
| Catalog # | SMC-432D-A488 |
| Price | |
| Order / More Info | SUR1/SUR2B Antibody from STRESSMARQ BIOSCIENCES INC. |
| Product Specific References | n/a |
| 产品资料 |
|
|