| Edit |   |
|---|
| Antigenic Specificity | Epithelial Splicing Regulatory Protein 2 (ESRP2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing. |
|---|
| Immunogen | RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ |
|---|
| Other Names | RBM35B|9530027K23Rik|Rbm35b|RGD1310855|cb404|fa07a06|rbm35b|sb:cb404|zgc:77254 |
|---|
| Gene, Accession # | Gene ID: 80004,77411,307810 |
|---|
| Catalog # | ABIN633540 |
|---|
| Price | |
|---|
| Order / More Info | Epithelial Splicing Regulatory Protein 2 (ESRP2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|