| Edit |   |
|---|
| Antigenic Specificity | Epithelial Stromal Interaction 1 (Breast) (EPSTI1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known. |
|---|
| Immunogen | EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK |
|---|
| Other Names | EPSTI1|BRESI1|2310046K10Rik|5033415K03Rik|RGD1563207 |
|---|
| Gene, Accession # | Gene ID: 94240 |
|---|
| Catalog # | ABIN635669 |
|---|
| Price | |
|---|
| Order / More Info | Epithelial Stromal Interaction 1 (Breast) (EPSTI1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|