| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEIS1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MEIS1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MEIS1 (26-60aa DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | homeobox protein Meis1; Homeobox protein Meis1; homeobox protein Meis1; Meis homeobox 1, MEIS1; MEIS1 |
|---|
| Gene, Accession # | MEIS1, Gene ID: 4211, NCBI: NP_002389.1, UniProt: O00470 |
|---|
| Catalog # | MBS178012 |
|---|
| Price | |
|---|
| Order / More Info | MEIS1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: MEIS1 Meis homeobox 1. 2. Moskow, J. J., Bullrich, F., Huebner, K., Daar, I. O., Buchberg, A. M. Meis1, a PBX1-related homeobox gene involved in myeloid leukemia in BXH-2 mice. Molec. Cell. Biol. 15: 5434-5443, 1995. 3. Wong, P., Iwasaki, M., Sommervaille, T. C. P., So, C. W. E., Cleary, M. L. Meis1 is an essential and rate-limiting regulator of MLL leukemia stem cell potential. Genes Dev. 21: 2762-2774, 2007. Note: Erratum: Genes Dev. 21: 3017 only, 2007. |
|---|
| 产品资料 |
|
|