| Edit |   |
| Antigenic Specificity | Prostaglandin E Receptor EP4/PTGER4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human. No cross reactivity with other proteins. Prostaglandin E2 receptor 4 (EP4) is a prostaglandin receptor encoded by the PTGER4 gene in humans. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences. |
| Other Names | Prostaglandin E2 receptor EP4 subtype;PGE receptor EP4 subtype;PGE2 receptor EP4 subtype;Prostanoid EP4 receptor;PTGER4;PTGER2; |
| Gene, Accession # | PTGER4, UniProt: P35408 |
| Catalog # | A02153-2 |
| Price | |
| Order / More Info | Prostaglandin E Receptor EP4/PTGER4 Antibody from BOSTER BIO |
| Product Specific References | n/a |